SCOPe 2.04: Domain d1swed_: 1swe D:

Lineage for d1swed_ (1swe D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (123 PDB entries)

8. Domain d1swed_: 1swe D: [27382]
   complexed with btn

Details for d1swed_

PDB Entry: 1swe, 2.06 Å

PDB Description: apo-core-streptavidin in complex with biotin at ph 4.5

PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d1swed_:

Sequence; same for both SEQRES and ATOM records:

>d1swed_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d1swed_:

• d1swed_ first appeared (with stable ids) in SCOP 1.55
  
• d1swed_ appears in SCOPe 2.03
  
• d1swed_ appears in SCOPe 2.05
  
• d1swed_ appears in the current release, SCOPe 2.08