Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
Protein Trehalose repressor, C-terminal domain [53839] (2 species) |
Species Escherichia coli [TaxId:83333] [273817] (1 PDB entry) |
Domain d4xxha_: 4xxh A: [273818] automated match to d1byka_ complexed with t6p |
PDB Entry: 4xxh (more details), 2.4 Å
SCOPe Domain Sequences for d4xxha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xxha_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 83333]} sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt grsepqqiiipatls
Timeline for d4xxha_: