![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
![]() | Protein HIV-1 capsid protein [47945] (1 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) |
![]() | Domain d4xfxa1: 4xfx A:1-147 [273811] Other proteins in same PDB: d4xfxa2 automated match to d2m8la1 complexed with cl, iod |
PDB Entry: 4xfx (more details), 2.43 Å
SCOPe Domain Sequences for d4xfxa1:
Sequence, based on SEQRES records: (download)
>d4xfxa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmysp
>d4xfxa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaa mqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppip vgeiykrwiilglnkivrmysp
Timeline for d4xfxa1: