SCOPe 2.08: Domain d4xfxa1: 4xfx A:1-147

Lineage for d4xfxa1 (4xfx A:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d4xfxa1: 4xfx A:1-147 [273811]
   Other proteins in same PDB: d4xfxa2
   automated match to d2m8la1
   complexed with cl, iod

Details for d4xfxa1

PDB Entry: 4xfx, 2.43 Å

PDB Description: structure of the native full-length hiv-1 capsid protein

PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d4xfxa1:

Sequence, based on SEQRES records:

>d4xfxa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d4xfxa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaa
mqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppip
vgeiykrwiilglnkivrmysp

Timeline for d4xfxa1:

• d4xfxa1 first appeared in SCOPe 2.05
  
• d4xfxa1 appears in SCOPe 2.07