Lineage for d4xfxa1 (4xfx A:1-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000631Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2000632Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2000633Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)
  6. 2000672Protein HIV-1 capsid protein [47945] (1 species)
  7. 2000673Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)
  8. 2000740Domain d4xfxa1: 4xfx A:1-147 [273811]
    Other proteins in same PDB: d4xfxa2
    automated match to d2m8la1
    complexed with cl, iod

Details for d4xfxa1

PDB Entry: 4xfx (more details), 2.43 Å

PDB Description: structure of the native full-length hiv-1 capsid protein
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d4xfxa1:

Sequence, based on SEQRES records: (download)

>d4xfxa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d4xfxa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaa
mqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppip
vgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d4xfxa1:

Click to download the PDB-style file with coordinates for d4xfxa1.
(The format of our PDB-style files is described here.)

Timeline for d4xfxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xfxa2