![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
![]() | Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
![]() | Protein automated matches [191156] (8 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [273803] (5 PDB entries) |
![]() | Domain d4xfza2: 4xfz A:148-221 [273810] Other proteins in same PDB: d4xfza1 automated match to d2m8pa2 complexed with 1b0, cl, iod |
PDB Entry: 4xfz (more details), 2.7 Å
SCOPe Domain Sequences for d4xfza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xfza2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]} tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp gatleemmtacqgv
Timeline for d4xfza2: