SCOP 1.65: Domain d1swec_: 1swe C:

Lineage for d1swec_ (1swe C:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (98 PDB entries)

8. Domain d1swec_: 1swe C: [27381]

Details for d1swec_

PDB Entry: 1swe, 2.1 Å

PDB Description: apo-core-streptavidin in complex with biotin at ph 4.5

SCOP Domain Sequences for d1swec_:

Sequence; same for both SEQRES and ATOM records:

>d1swec_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d1swec_:

• d1swec_ first appeared (with stable ids) in SCOP 1.55
  
• d1swec_ appears in SCOP 1.63
  
• d1swec_ appears in SCOP 1.67
  
• d1swec_ appears in the current release, SCOPe 2.08