SCOPe 2.08: Domain d4xfsa_: 4xfs A:

Lineage for d4xfsa_ (4xfs A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)

6. Protein automated matches [190999] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188735] (17 PDB entries)

8. Domain d4xfsa_: 4xfs A: [273801]
   automated match to d3wo2a_
   complexed with dms, gol; mutant

Details for d4xfsa_

PDB Entry: 4xfs, 1.91 Å

PDB Description: structure of il-18 ser mutant i

PDB Compounds: (A:) Interleukin-18

SCOPe Domain Sequences for d4xfsa_:

Sequence; same for both SEQRES and ATOM records:

>d4xfsa_ b.42.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
egyflacekerdlfklilaaadaagdrsimftvqne

Timeline for d4xfsa_:

• d4xfsa_ first appeared in SCOPe 2.05
  
• d4xfsa_ appears in SCOPe 2.07