Lineage for d4xftb_ (4xft B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053109Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2053419Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 protein domains)
  6. 2053480Protein automated matches [190999] (1 species)
    not a true protein
  7. 2053481Species Human (Homo sapiens) [TaxId:9606] [188735] (17 PDB entries)
  8. 2053495Domain d4xftb_: 4xft B: [273800]
    automated match to d3wo2a_
    complexed with dms; mutant

Details for d4xftb_

PDB Entry: 4xft (more details), 2 Å

PDB Description: structure of il-18 ser mutant iii
PDB Compounds: (B:) Interleukin-18

SCOPe Domain Sequences for d4xftb_:

Sequence, based on SEQRES records: (download)

>d4xftb_ b.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
avtisvacaaastlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
egyflacekerdlfklilkkedelgdrsimftvqne

Sequence, based on observed residues (ATOM records): (download)

>d4xftb_ b.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
avtisvacaaastlscenkiisfkemnppdnikdtksdiiffqrsvpgdnkmqfesssye
gyflacekerdlfklilkkeelgdrsimftvqne

SCOPe Domain Coordinates for d4xftb_:

Click to download the PDB-style file with coordinates for d4xftb_.
(The format of our PDB-style files is described here.)

Timeline for d4xftb_: