Lineage for d1sweb_ (1swe B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62326Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 62327Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 62328Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 62343Protein Streptavidin [50878] (1 species)
  7. 62344Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)
  8. 62483Domain d1sweb_: 1swe B: [27380]

Details for d1sweb_

PDB Entry: 1swe (more details), 2.1 Å

PDB Description: apo-core-streptavidin in complex with biotin at ph 4.5

SCOP Domain Sequences for d1sweb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sweb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOP Domain Coordinates for d1sweb_:

Click to download the PDB-style file with coordinates for d1sweb_.
(The format of our PDB-style files is described here.)

Timeline for d1sweb_: