Lineage for d4xcod_ (4xco D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709937Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 2709938Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) (S)
  5. 2709973Family a.36.1.0: automated matches [273795] (1 protein)
    not a true family
  6. 2709974Protein automated matches [273796] (2 species)
    not a true protein
  7. 2709977Species Methanocaldococcus jannaschii [TaxId:2190] [273797] (1 PDB entry)
  8. 2709978Domain d4xcod_: 4xco D: [273798]
    Other proteins in same PDB: d4xcoa_, d4xcob_
    automated match to d1hq1a_
    complexed with mg, na

Details for d4xcod_

PDB Entry: 4xco (more details), 2.9 Å

PDB Description: signal-sequence induced conformational changes in the signal recognition particle
PDB Compounds: (D:) Signal recognition particle 54 kDa protein,signal sequence

SCOPe Domain Sequences for d4xcod_:

Sequence, based on SEQRES records: (download)

>d4xcod_ a.36.1.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
daimrgkftlnelmtqleaienmgsmkkilsmipgfggampkelshlteakikkykviis
smtkeerenpkiikasrirriargsgttendvrevlryyettknaidklrkg

Sequence, based on observed residues (ATOM records): (download)

>d4xcod_ a.36.1.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
daimrgkftlnelmtqleaienmgsmklteakikkykviissmtkeerenpkiikasrir
riargsgttendvrevlryyettknaidklrkg

SCOPe Domain Coordinates for d4xcod_:

Click to download the PDB-style file with coordinates for d4xcod_.
(The format of our PDB-style files is described here.)

Timeline for d4xcod_: