| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.36: Signal peptide-binding domain [47445] (1 superfamily) 4 helices; orthogonal array |
Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) ![]() |
| Family a.36.1.0: automated matches [273795] (1 protein) not a true family |
| Protein automated matches [273796] (2 species) not a true protein |
| Species Methanocaldococcus jannaschii [TaxId:2190] [273797] (1 PDB entry) |
| Domain d4xcod_: 4xco D: [273798] Other proteins in same PDB: d4xcoa_, d4xcob_ automated match to d1hq1a_ complexed with mg, na |
PDB Entry: 4xco (more details), 2.9 Å
SCOPe Domain Sequences for d4xcod_:
Sequence, based on SEQRES records: (download)
>d4xcod_ a.36.1.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
daimrgkftlnelmtqleaienmgsmkkilsmipgfggampkelshlteakikkykviis
smtkeerenpkiikasrirriargsgttendvrevlryyettknaidklrkg
>d4xcod_ a.36.1.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
daimrgkftlnelmtqleaienmgsmklteakikkykviissmtkeerenpkiikasrir
riargsgttendvrevlryyettknaidklrkg
Timeline for d4xcod_: