Lineage for d4x6ua1 (4x6u A:4-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900958Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2901042Protein automated matches [190277] (12 species)
    not a true protein
  7. 2901067Species Geobacillus stearothermophilus [TaxId:1422] [226739] (12 PDB entries)
  8. 2901077Domain d4x6ua1: 4x6u A:4-389 [273788]
    Other proteins in same PDB: d4x6ua2
    automated match to d3umjb_
    complexed with ca, zn

Details for d4x6ua1

PDB Entry: 4x6u (more details), 2.2 Å

PDB Description: crystal structure of lipase from geobacillus stearothermophilus t6
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d4x6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x6ua1 c.69.1.18 (A:4-389) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
srandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdr
aceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarml
vsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffd
lqkavlkaaavasnvpytsqvydfkldqwglrrqpgesfdqyferlkrspvwtstdtary
dlsvpgaeklnqwvkaspntyylsfatertyrgaltgnyypelgmnafsavvcapflgsy
rnatlgiddrwlendgivnafsmngpkrgstdrivpydgtikkgvwndmgtynvdhlevi
gvdpnplfdirafylrlaeqlaslqp

SCOPe Domain Coordinates for d4x6ua1:

Click to download the PDB-style file with coordinates for d4x6ua1.
(The format of our PDB-style files is described here.)

Timeline for d4x6ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4x6ua2