![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
![]() | Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
![]() | Protein automated matches [190412] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187287] (9 PDB entries) |
![]() | Domain d4x25b_: 4x25 B: [273785] automated match to d2vk3a_ mutant |
PDB Entry: 4x25 (more details), 2.23 Å
SCOPe Domain Sequences for d4x25b_:
Sequence, based on SEQRES records: (download)
>d4x25b_ d.110.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgvlvgkdrssfyv ngltlggqkcsvirdsllqdgefsmdlrtkstggaptfnvtvtktdktlvlltgkegvhg glinkkcyemashlrrsqy
>d4x25b_ d.110.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} agwnayidnlmdgtcqdaaivgykdspsvwaavpgktfvnitpaevgvlvgkdrssfyvn gltlggqkcsvirdsllqdgefsmdlrttfnvtvtktdktlvlltgkegvhgglinkkcy emashlrrsqy
Timeline for d4x25b_: