Lineage for d1swsd_ (1sws D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378912Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 378913Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 378914Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 378937Protein Streptavidin [50878] (1 species)
  7. 378938Species Streptomyces avidinii [TaxId:1895] [50879] (113 PDB entries)
  8. 379162Domain d1swsd_: 1sws D: [27378]
    mutant

Details for d1swsd_

PDB Entry: 1sws (more details), 2 Å

PDB Description: core-streptavidin mutant d128a at ph 4.5

SCOP Domain Sequences for d1swsd_:

Sequence, based on SEQRES records: (download)

>d1swsd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghatftk

Sequence, based on observed residues (ATOM records): (download)

>d1swsd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyeaesryvltgrydsapatdgsgtalgwtvawk
nnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghatftk

SCOP Domain Coordinates for d1swsd_:

Click to download the PDB-style file with coordinates for d1swsd_.
(The format of our PDB-style files is described here.)

Timeline for d1swsd_: