| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) ![]() automatically mapped to Pfam PF02284 |
| Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
| Protein Cytochrome c oxidase subunit E [48481] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries) |
| Domain d3x2qr_: 3x2q R: [273771] Other proteins in same PDB: d3x2qa_, d3x2qb1, d3x2qb2, d3x2qc_, d3x2qd_, d3x2qf_, d3x2qg_, d3x2qh_, d3x2qi_, d3x2qj_, d3x2qk_, d3x2ql_, d3x2qm_, d3x2qn_, d3x2qo1, d3x2qo2, d3x2qp_, d3x2qq_, d3x2qs_, d3x2qt_, d3x2qu_, d3x2qv_, d3x2qw_, d3x2qx_, d3x2qy_, d3x2qz_ automated match to d1v54e_ complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3x2q (more details), 2 Å
SCOPe Domain Sequences for d3x2qr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x2qr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d3x2qr_:
View in 3DDomains from other chains: (mouse over for more information) d3x2qa_, d3x2qb1, d3x2qb2, d3x2qc_, d3x2qd_, d3x2qe_, d3x2qf_, d3x2qg_, d3x2qh_, d3x2qi_, d3x2qj_, d3x2qk_, d3x2ql_, d3x2qm_, d3x2qn_, d3x2qo1, d3x2qo2, d3x2qp_, d3x2qq_, d3x2qs_, d3x2qt_, d3x2qu_, d3x2qv_, d3x2qw_, d3x2qx_, d3x2qy_, d3x2qz_ |