Lineage for d3x2qb1 (3x2q B:1-90)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956758Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 1956780Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1956781Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1956826Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1956827Species Cow (Bos taurus) [TaxId:9913] [81454] (26 PDB entries)
  8. 1956868Domain d3x2qb1: 3x2q B:1-90 [273755]
    Other proteins in same PDB: d3x2qa_, d3x2qb2, d3x2qc_, d3x2qd_, d3x2qe_, d3x2qf_, d3x2qg_, d3x2qh_, d3x2qi_, d3x2qj_, d3x2qk_, d3x2ql_, d3x2qm_, d3x2qn_, d3x2qo2, d3x2qp_, d3x2qq_, d3x2qr_, d3x2qs_, d3x2qt_, d3x2qu_, d3x2qv_, d3x2qw_, d3x2qx_, d3x2qy_, d3x2qz_
    automated match to d1v54b2
    complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3x2qb1

PDB Entry: 3x2q (more details), 2 Å

PDB Description: x-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3x2qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x2qb1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d3x2qb1:

Click to download the PDB-style file with coordinates for d3x2qb1.
(The format of our PDB-style files is described here.)

Timeline for d3x2qb1: