SCOPe 2.05: Domain d3wx8c_: 3wx8 C:

Lineage for d3wx8c_ (3wx8 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (15 species)
   not a true protein

7. Species Drosophila melanogaster [TaxId:7227] [273749] (1 PDB entry)

8. Domain d3wx8c_: 3wx8 C: [273752]
   automated match to d1nsqa_

Details for d3wx8c_

PDB Entry: 3wx8, 1.95 Å

PDB Description: purification, characterization and structure of nucleoside diphosphate kinase from drosophila s2 cells

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3wx8c_:

Sequence; same for both SEQRES and ATOM records:

>d3wx8c_ d.58.6.1 (C:) automated matches {Drosophila melanogaster [TaxId: 7227]}
aankertfimvkpdgvqrglvgkiierfeqkgfrlvalkftwaskellekhyadlsarpf
fpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadskpgtirgdfciqvgrniihgs
davksaekeialwfnekelvtwtpaakdwiye

Timeline for d3wx8c_:

• d3wx8c_ is new in SCOPe 2.05-stable
  
• d3wx8c_ appears in SCOPe 2.06
  
• d3wx8c_ appears in the current release, SCOPe 2.08