Lineage for d3wx8a_ (3wx8 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194613Protein automated matches [190032] (18 species)
    not a true protein
  7. 2194732Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [273749] (1 PDB entry)
  8. 2194733Domain d3wx8a_: 3wx8 A: [273751]
    automated match to d1nsqa_

Details for d3wx8a_

PDB Entry: 3wx8 (more details), 1.95 Å

PDB Description: purification, characterization and structure of nucleoside diphosphate kinase from drosophila s2 cells
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3wx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wx8a_ d.58.6.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
maankertfimvkpdgvqrglvgkiierfeqkgfrlvalkftwaskellekhyadlsarp
ffpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadskpgtirgdfciqvgrniihg
sdavksaekeialwfnekelvtwtpaakdwiye

SCOPe Domain Coordinates for d3wx8a_:

Click to download the PDB-style file with coordinates for d3wx8a_.
(The format of our PDB-style files is described here.)

Timeline for d3wx8a_: