SCOPe 2.07: Domain d3wx8b_: 3wx8 B:

Lineage for d3wx8b_ (3wx8 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [273749] (1 PDB entry)

8. Domain d3wx8b_: 3wx8 B: [273750]
   automated match to d1nsqa_

Details for d3wx8b_

PDB Entry: 3wx8, 1.95 Å

PDB Description: purification, characterization and structure of nucleoside diphosphate kinase from drosophila s2 cells

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3wx8b_:

Sequence; same for both SEQRES and ATOM records:

>d3wx8b_ d.58.6.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
maankertfimvkpdgvqrglvgkiierfeqkgfrlvalkftwaskellekhyadlsarp
ffpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadskpgtirgdfciqvgrniihg
sdavksaekeialwfnekelvtwtpaakdwiye

Timeline for d3wx8b_:

• d3wx8b_ first appeared in SCOPe 2.05
  
• d3wx8b_ appears in SCOPe 2.06
  
• d3wx8b_ appears in the current release, SCOPe 2.08