Lineage for d3wvta2 (3wvt A:98-141)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034830Family g.24.1.0: automated matches [227277] (1 protein)
    not a true family
  6. 3034831Protein automated matches [227086] (2 species)
    not a true protein
  7. 3034832Species Horse (Equus caballus) [TaxId:9796] [273745] (1 PDB entry)
  8. 3034834Domain d3wvta2: 3wvt A:98-141 [273747]
    automated match to d1jmab2

Details for d3wvta2

PDB Entry: 3wvt (more details), 1.6 Å

PDB Description: structural and biochemical study of equine lentivirus receptor 1
PDB Compounds: (A:) elr1

SCOPe Domain Sequences for d3wvta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wvta2 g.24.1.0 (A:98-141) automated matches {Horse (Equus caballus) [TaxId: 9796]}
pcdpamglvirrdcsstentecgcdqghfcvsekgddcvecqph

SCOPe Domain Coordinates for d3wvta2:

Click to download the PDB-style file with coordinates for d3wvta2.
(The format of our PDB-style files is described here.)

Timeline for d3wvta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wvta1