Lineage for d4wchd_ (4wch D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688659Species Glossoscolex paulistus [TaxId:1046353] [273742] (1 PDB entry)
  8. 2688660Domain d4wchd_: 4wch D: [273743]
    automated match to d1x9fd_
    complexed with hem, oxy

Details for d4wchd_

PDB Entry: 4wch (more details), 2.05 Å

PDB Description: structure of isolated d chain of gigant hemoglobin from glossoscolex paulistus
PDB Compounds: (D:) Isolated Chain D of Gigant Hemoglobin from Glossoscolex Paulistus

SCOPe Domain Sequences for d4wchd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wchd_ a.1.1.2 (D:) automated matches {Glossoscolex paulistus [TaxId: 1046353]}
dcsilellkvknqwreafgeghhrvqfglelwkrffdthpevkglfkgvngdniyspefa
ahaervlsgldmtigllddtnafkaqvthlhsqhversinpefyehflgallhvlpkylg
tkldqdawtkcfhtiadgik

SCOPe Domain Coordinates for d4wchd_:

Click to download the PDB-style file with coordinates for d4wchd_.
(The format of our PDB-style files is described here.)

Timeline for d4wchd_: