Lineage for d4uhfa_ (4uhf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871465Species Planctomycetes bacterium [TaxId:1331910] [273731] (5 PDB entries)
  8. 1871469Domain d4uhfa_: 4uhf A: [273735]
    automated match to d3kxpe_
    complexed with bua, cad, pge; mutant

Details for d4uhfa_

PDB Entry: 4uhf (more details), 1.08 Å

PDB Description: structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound)
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d4uhfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhfa_ c.69.1.0 (A:) automated matches {Planctomycetes bacterium [TaxId: 1331910]}
aqrvkitttatpgeielafedtgtglpvllvhgfpldrtmwkaqreelcdefrvivpdlr
gfgesqvipgvatmeamaddlaglcnhlgltgkivlgglsmggyvafafarkyrdrlagl
ilcdtrarpdspeakenrrrvaervrregpgfiaeemiprlccestfrnhpeviekirqm
ilsappegvaaaalgmaerpdstdllpalscptlvlvgqfdaisppeemeamartipqsq
fvvipdaghlppmeqpervtqairewlrkvhteaghhh

SCOPe Domain Coordinates for d4uhfa_:

Click to download the PDB-style file with coordinates for d4uhfa_.
(The format of our PDB-style files is described here.)

Timeline for d4uhfa_:

  • d4uhfa_ appears in periodic updates to SCOPe 2.05 starting on 2015-06-10
  • d4uhfa_ is called d4uhfa1 in SCOPe 2.06
  • d4uhfa_ appears in the current release, SCOPe 2.07, called d4uhfa1