| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (131 species) not a true protein |
| Species Planctomycetes bacterium [TaxId:1331910] [273731] (5 PDB entries) |
| Domain d4uhfa1: 4uhf A:2-275 [273735] Other proteins in same PDB: d4uhfa2 automated match to d3kxpe_ complexed with bua, cad, pge; mutant |
PDB Entry: 4uhf (more details), 1.08 Å
SCOPe Domain Sequences for d4uhfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uhfa1 c.69.1.0 (A:2-275) automated matches {Planctomycetes bacterium [TaxId: 1331910]}
aqrvkitttatpgeielafedtgtglpvllvhgfpldrtmwkaqreelcdefrvivpdlr
gfgesqvipgvatmeamaddlaglcnhlgltgkivlgglsmggyvafafarkyrdrlagl
ilcdtrarpdspeakenrrrvaervrregpgfiaeemiprlccestfrnhpeviekirqm
ilsappegvaaaalgmaerpdstdllpalscptlvlvgqfdaisppeemeamartipqsq
fvvipdaghlppmeqpervtqairewlrkvhtea
Timeline for d4uhfa1: