Lineage for d4uhha_ (4uhh A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510183Species Planctomycetes bacterium [TaxId:1331910] [273731] (5 PDB entries)
  8. 2510185Domain d4uhha_: 4uhh A: [273734]
    automated match to d3kxpe_
    complexed with cad, cl, peg

Details for d4uhha_

PDB Entry: 4uhh (more details), 1.06 Å

PDB Description: structural studies of a thermophilic esterase from thermogutta terrifontis (cacodylate complex)
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d4uhha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhha_ c.69.1.0 (A:) automated matches {Planctomycetes bacterium [TaxId: 1331910]}
aqrvkitttatpgeielafedtgtglpvllvhgfpldrtmwkaqreelcdefrvivpdlr
gfgesqvipgvatmeamaddlaglcnhlgltgkivlgglsmggyvafafarkyrdrlagl
ilcdtrarpdspeakenrrrvaervrregpgfiaeemiprlccestfrnhpeviekirqm
ilsappegvaaaalgmaerpdstdllpalscptlvlvgqfdaisppeemeamartipqsq
fvvipdaghlppmeqpervtqairewlrkvhte

SCOPe Domain Coordinates for d4uhha_:

Click to download the PDB-style file with coordinates for d4uhha_.
(The format of our PDB-style files is described here.)

Timeline for d4uhha_: