Lineage for d4uhca1 (4uhc A:2-275)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902689Species Planctomycetes bacterium [TaxId:1331910] [273731] (5 PDB entries)
  8. 2902690Domain d4uhca1: 4uhc A:2-275 [273733]
    Other proteins in same PDB: d4uhca2
    automated match to d3kxpe_
    complexed with cl

Details for d4uhca1

PDB Entry: 4uhc (more details), 1.03 Å

PDB Description: structural studies of a thermophilic esterase from thermogutta terrifontis (native)
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d4uhca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhca1 c.69.1.0 (A:2-275) automated matches {Planctomycetes bacterium [TaxId: 1331910]}
aqrvkitttatpgeielafedtgtglpvllvhgfpldrtmwkaqreelcdefrvivpdlr
gfgesqvipgvatmeamaddlaglcnhlgltgkivlgglsmggyvafafarkyrdrlagl
ilcdtrarpdspeakenrrrvaervrregpgfiaeemiprlccestfrnhpeviekirqm
ilsappegvaaaalgmaerpdstdllpalscptlvlvgqfdaisppeemeamartipqsq
fvvipdaghlppmeqpervtqairewlrkvhtea

SCOPe Domain Coordinates for d4uhca1:

Click to download the PDB-style file with coordinates for d4uhca1.
(The format of our PDB-style files is described here.)

Timeline for d4uhca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uhca2