SCOP 1.73: Domain d1swjc_: 1swj C:

Lineage for d1swjc_ (1swj C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)

8. Domain d1swjc_: 1swj C: [27373]

Details for d1swjc_

PDB Entry: 1swj, 2 Å

PDB Description: core-streptavidin mutant w79f at ph 4.5

PDB Compounds: (C:) core-streptavidin

SCOP Domain Sequences for d1swjc_:

Sequence; same for both SEQRES and ATOM records:

>d1swjc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvafknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk

Timeline for d1swjc_:

• d1swjc_ first appeared (with stable ids) in SCOP 1.55
  
• d1swjc_ appears in SCOP 1.71
  
• d1swjc_ appears in SCOP 1.75
  
• d1swjc_ appears in the current release, SCOPe 2.08