SCOPe 2.08: Domain d4tq9b1: 4tq9 B:1-168

Lineage for d4tq9b1 (4tq9 B:1-168)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d4tq9b1: 4tq9 B:1-168 [273729]
   Other proteins in same PDB: d4tq9a2, d4tq9b2
   automated match to d4obeb_
   complexed with gdp, mg; mutant

Details for d4tq9b1

PDB Entry: 4tq9, 1.49 Å

PDB Description: crystal structure of a gdp-bound g12v oncogenic mutant of human gtpase kras

PDB Compounds: (B:) GTPase KRas

SCOPe Domain Sequences for d4tq9b1:

Sequence; same for both SEQRES and ATOM records:

>d4tq9b1 c.37.1.8 (B:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Timeline for d4tq9b1:

• d4tq9b1 first appeared in SCOPe 2.05, called d4tq9b_
  
• d4tq9b1 appears in SCOPe 2.07