| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein automated matches [190047] (37 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries) |
| Domain d4tqaa1: 4tqa A:1-168 [273727] Other proteins in same PDB: d4tqaa2, d4tqab2 automated match to d4obeb_ complexed with gdp, mg; mutant |
PDB Entry: 4tqa (more details), 1.13 Å
SCOPe Domain Sequences for d4tqaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tqaa1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgagdvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
Timeline for d4tqaa1: