Lineage for d4toza_ (4toz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145794Species Escherichia coli [TaxId:83333] [271371] (2 PDB entries)
  8. 2145795Domain d4toza_: 4toz A: [273725]
    Other proteins in same PDB: d4tozb2
    automated match to d3tcha_
    complexed with trs

Details for d4toza_

PDB Entry: 4toz (more details), 1.5 Å

PDB Description: mppa periplasmic murein tripeptide binding protein, unliganded open form
PDB Compounds: (A:) Periplasmic murein peptide-binding protein

SCOPe Domain Sequences for d4toza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4toza_ c.94.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
aevpsgtvlaekqelvrhikdepasldpakavglpeiqvirdlfeglvnqnekgeivpgv
atqwksndnriwtftlrdnakwadgtpvtaqdfvyswqrlvdpktlspfawfaalaginn
aqaiidgkatpdqlgvtavdahtlkiqldkplpwfvnltanfaffpvqkanvesgkewtk
pgnligngayvlkervvneklvvvpnthywdnaktvlqkvtflpinqesaatkrylagdi
ditesfpknmyqkllkdipgqvytppqlgtyyyafntqkgptadqrvrlalsmtidrrlm
tekvlgtgekpawhftpdvtagftpepspfeqmsqedlnaqaktllsaagygpqkplklt
llyntsenhqkiaiavasmwkknlgvdvklqnqewktyidsrntgnfdviraswvgdyne
pstfltlltsthsgnisrfnnpaydkvlaqastentvkarnadynaaekilmeqapiapi
yqytngrlikpwlkgypinnpedvaysrtmyivkh

SCOPe Domain Coordinates for d4toza_:

Click to download the PDB-style file with coordinates for d4toza_.
(The format of our PDB-style files is described here.)

Timeline for d4toza_: