SCOPe 2.05: Domain d4tn5b_: 4tn5 B:

Lineage for d4tn5b_ (4tn5 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.2: PTS system IIB component-like [52794] (3 families)

5. Family c.44.2.0: automated matches [254256] (1 protein)
   not a true family

6. Protein automated matches [254590] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [256814] (2 PDB entries)

8. Domain d4tn5b_: 4tn5 B: [273724]
   automated match to d4jxda_
   complexed with ni

Details for d4tn5b_

PDB Entry: 4tn5, 2.29 Å

PDB Description: crystal structure of predicted fructose specific iib from escherichia coli

PDB Compounds: (B:) Fructose-like phosphotransferase enzyme IIB component 3

SCOPe Domain Sequences for d4tn5b_:

Sequence; same for both SEQRES and ATOM records:

>d4tn5b_ c.44.2.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
maylvavtacvsgvahtymaaerleklcllekwgvsietqgalgtenrladedirradva
llitdielagaerfehcryvqcsiyaflrepqrvmsavrkvlsapqqthlile

Timeline for d4tn5b_:

• d4tn5b_ is new in SCOPe 2.05-stable
  
• d4tn5b_ appears in SCOPe 2.06
  
• d4tn5b_ appears in the current release, SCOPe 2.08