SCOPe 2.08: Domain d4tozb1: 4toz B:26-537

Lineage for d4tozb1 (4toz B:26-537)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [271371] (5 PDB entries)

8. Domain d4tozb1: 4toz B:26-537 [273722]
   Other proteins in same PDB: d4tozb2
   automated match to d3tcha_
   complexed with trs

Details for d4tozb1

PDB Entry: 4toz, 1.5 Å

PDB Description: mppa periplasmic murein tripeptide binding protein, unliganded open form

PDB Compounds: (B:) Periplasmic murein peptide-binding protein

SCOPe Domain Sequences for d4tozb1:

Sequence; same for both SEQRES and ATOM records:

>d4tozb1 c.94.1.0 (B:26-537) automated matches {Escherichia coli [TaxId: 83333]}
psgtvlaekqelvrhikdepasldpakavglpeiqvirdlfeglvnqnekgeivpgvatq
wksndnriwtftlrdnakwadgtpvtaqdfvyswqrlvdpktlspfawfaalaginnaqa
iidgkatpdqlgvtavdahtlkiqldkplpwfvnltanfaffpvqkanvesgkewtkpgn
ligngayvlkervvneklvvvpnthywdnaktvlqkvtflpinqesaatkrylagdidit
esfpknmyqkllkdipgqvytppqlgtyyyafntqkgptadqrvrlalsmtidrrlmtek
vlgtgekpawhftpdvtagftpepspfeqmsqedlnaqaktllsaagygpqkplkltlly
ntsenhqkiaiavasmwkknlgvdvklqnqewktyidsrntgnfdviraswvgdynepst
fltlltsthsgnisrfnnpaydkvlaqastentvkarnadynaaekilmeqapiapiyqy
tngrlikpwlkgypinnpedvaysrtmyivkh

Timeline for d4tozb1:

• d4tozb1 first appeared in SCOPe 2.05, called d4tozb_
  
• d4tozb1 appears in SCOPe 2.07