Lineage for d4qzga3 (4qzg A:303-510)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944794Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1944795Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1944803Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 1945043Protein automated matches [254484] (3 species)
    not a true protein
  7. 1945049Species Mouse (Mus musculus) [TaxId:10090] [256295] (28 PDB entries)
  8. 1945076Domain d4qzga3: 4qzg A:303-510 [273709]
    Other proteins in same PDB: d4qzga1, d4qzga2
    automated match to d1jmsa4
    protein/DNA complex; complexed with dct, mg, na; mutant

Details for d4qzga3

PDB Entry: 4qzg (more details), 2.75 Å

PDB Description: mouse tdt, f401a mutant, in complex with a dsb substrate, c-c base pair
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4qzga3:

Sequence, based on SEQRES records: (download)

>d4qzga3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhaqkcflilkldhgrvhseksgq
qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk
rvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records): (download)

>d4qzga3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilesdhaqkcflilkldhgrvhgkgwkairvdlvmcpydrraf
allgwtgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiep
werna

SCOPe Domain Coordinates for d4qzga3:

Click to download the PDB-style file with coordinates for d4qzga3.
(The format of our PDB-style files is described here.)

Timeline for d4qzga3: