Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
Protein automated matches [254482] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255236] (29 PDB entries) |
Domain d4qzfa1: 4qzf A:147-242 [273704] Other proteins in same PDB: d4qzfa2, d4qzfa3 automated match to d1jmsa1 protein/DNA complex; complexed with dct, mg, na; mutant |
PDB Entry: 4qzf (more details), 2.6 Å
SCOPe Domain Sequences for d4qzfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qzfa1 a.60.6.0 (A:147-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vkkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpit smkdtegipclgdkvksiiegiiedgesseakavln
Timeline for d4qzfa1: