![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
![]() | Protein automated matches [254482] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255236] (31 PDB entries) |
![]() | Domain d4qz9a1: 4qz9 A:147-242 [273689] Other proteins in same PDB: d4qz9a2, d4qz9a3 automated match to d1jmsa1 protein/DNA complex; complexed with dct, mg, na |
PDB Entry: 4qz9 (more details), 2.05 Å
SCOPe Domain Sequences for d4qz9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qz9a1 a.60.6.0 (A:147-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vkkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpit smkdtegipclgdkvksiiegiiedgesseakavln
Timeline for d4qz9a1: