SCOPe 2.06: Domain d4qt2a1: 4qt2 A:7-127

Lineage for d4qt2a1 (4qt2 A:7-127)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (27 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [195450] (5 PDB entries)

8. Domain d4qt2a1: 4qt2 A:7-127 [273684]
   Other proteins in same PDB: d4qt2a2
   automated match to d2ofna_
   complexed with imd, rap

Details for d4qt2a1

PDB Entry: 4qt2, 1.44 Å

PDB Description: crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with rapamycin

PDB Compounds: (A:) FK506-binding protein (FKBP)-type peptidyl-propyl isomerase

SCOPe Domain Sequences for d4qt2a1:

Sequence; same for both SEQRES and ATOM records:

>d4qt2a1 d.26.1.0 (A:7-127) automated matches {Plasmodium falciparum [TaxId: 36329]}
fekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfdrnvpfk
fhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfeiellsfr
e

Timeline for d4qt2a1:

• d4qt2a1 first appeared in SCOPe 2.05, called d4qt2a_
  
• d4qt2a1 appears in SCOPe 2.07
  
• d4qt2a1 appears in the current release, SCOPe 2.08