Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.0: automated matches [273673] (1 protein) not a true family |
Protein automated matches [273674] (2 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273675] (3 PDB entries) |
Domain d4qkoh_: 4qko H: [273682] Other proteins in same PDB: d4qkoa_, d4qkoc_, d4qkoe_, d4qkog_ automated match to d3u43b_ complexed with br, mg |
PDB Entry: 4qko (more details), 1.8 Å
SCOPe Domain Sequences for d4qkoh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qkoh_ d.4.1.0 (H:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} rdprdvpgaatgkgqpvsgnwlgaasqgegapipsqiadklrgktfknwrdfreqfwiav andpelskqfnpgslavmrdggapyvreseqaggrikieihhkvriadgggvynmgnlva vtpkrhieihk
Timeline for d4qkoh_: