Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) automatically mapped to Pfam PF01320 |
Family a.28.2.0: automated matches [273669] (1 protein) not a true family |
Protein automated matches [273670] (1 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273671] (2 PDB entries) |
Domain d4qkog_: 4qko G: [273681] Other proteins in same PDB: d4qkob_, d4qkod_, d4qkof_, d4qkoh_ automated match to d2vloa_ complexed with br, mg |
PDB Entry: 4qko (more details), 1.8 Å
SCOPe Domain Sequences for d4qkog_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qkog_ a.28.2.0 (G:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} kskiseytekeflefvkdiytnnkkkfpteeshiqavlefkkltehpsgsdllyypnenr edspagvvkevkewraskglpgfkag
Timeline for d4qkog_: