Lineage for d4qkod_ (4qko D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2928000Family d.4.1.0: automated matches [273673] (1 protein)
    not a true family
  6. 2928001Protein automated matches [273674] (2 species)
    not a true protein
  7. 2928004Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273675] (3 PDB entries)
  8. 2928008Domain d4qkod_: 4qko D: [273677]
    Other proteins in same PDB: d4qkoa_, d4qkoc_, d4qkoe_, d4qkog_
    automated match to d3u43b_
    complexed with br, mg

Details for d4qkod_

PDB Entry: 4qko (more details), 1.8 Å

PDB Description: the crystal structure of the pyocin s2 nuclease domain, immunity protein complex at 1.8 angstroms
PDB Compounds: (D:) Pyocin-S2

SCOPe Domain Sequences for d4qkod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qkod_ d.4.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
rdprdvpgaatgkgqpvsgnwlgaasqgegapipsqiadklrgktfknwrdfreqfwiav
andpelskqfnpgslavmrdggapyvreseqaggrikieihhkvriadgggvynmgnlva
vtpkrhieihkgg

SCOPe Domain Coordinates for d4qkod_:

Click to download the PDB-style file with coordinates for d4qkod_.
(The format of our PDB-style files is described here.)

Timeline for d4qkod_: