Lineage for d4qkoa_ (4qko A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993555Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 1993611Family a.28.2.0: automated matches [273669] (1 protein)
    not a true family
  6. 1993612Protein automated matches [273670] (1 species)
    not a true protein
  7. 1993613Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273671] (2 PDB entries)
  8. 1993614Domain d4qkoa_: 4qko A: [273672]
    Other proteins in same PDB: d4qkob_, d4qkod_, d4qkof_, d4qkoh_
    automated match to d2vloa_
    complexed with br, mg

Details for d4qkoa_

PDB Entry: 4qko (more details), 1.8 Å

PDB Description: the crystal structure of the pyocin s2 nuclease domain, immunity protein complex at 1.8 angstroms
PDB Compounds: (A:) Pyocin-S2 immunity protein

SCOPe Domain Sequences for d4qkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qkoa_ a.28.2.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkskiseytekeflefvkdiytnnkkkfpteeshiqavlefkkltehpsgsdllyypnen
redspagvvkevkewraskglpgfkag

SCOPe Domain Coordinates for d4qkoa_:

Click to download the PDB-style file with coordinates for d4qkoa_.
(The format of our PDB-style files is described here.)

Timeline for d4qkoa_: