Lineage for d4qkql1 (4qkq L:61-322)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112413Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 2112424Species Methanococcus voltae [TaxId:2188] [110555] (14 PDB entries)
    Uniprot O73948
  8. 2112447Domain d4qkql1: 4qkq L:61-322 [273668]
    Other proteins in same PDB: d4qkqa2, d4qkqb2, d4qkqc2, d4qkqd2, d4qkqe2, d4qkqf2, d4qkqg2, d4qkqh2, d4qkqi2, d4qkqj2, d4qkqk2, d4qkql2
    automated match to d4dc9a_
    protein/DNA complex; complexed with 35n, no3

Details for d4qkql1

PDB Entry: 4qkq (more details), 2 Å

PDB Description: rada from methanococcus voltae in complex with copper phthalocyanine tetrasulfonate inhibitor
PDB Compounds: (L:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d4qkql1:

Sequence, based on SEQRES records: (download)

>d4qkql1 c.37.1.11 (L:61-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
dlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscv
nlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfva
raynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmat
lnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvakl
ydsphlpdaeaifritekgiqd

Sequence, based on observed residues (ATOM records): (download)

>d4qkql1 c.37.1.11 (L:61-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
dlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscv
nlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfva
raynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmat
lnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsphlpd
aeaifritekgiqd

SCOPe Domain Coordinates for d4qkql1:

Click to download the PDB-style file with coordinates for d4qkql1.
(The format of our PDB-style files is described here.)

Timeline for d4qkql1:

  • d4qkql1 first appeared in SCOPe 2.05, called d4qkql_