![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
![]() | Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
![]() | Protein automated matches [195117] (13 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:99287] [257522] (6 PDB entries) |
![]() | Domain d4qiee_: 4qie E: [273651] Other proteins in same PDB: d4qieh2 automated match to d2a10f_ complexed with gol, so4; mutant |
PDB Entry: 4qie (more details), 2.35 Å
SCOPe Domain Sequences for d4qiee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qiee_ d.58.56.0 (E:) automated matches {Salmonella enterica [TaxId: 99287]} qealgmvetkgltaaieaadamvdsanvmlvgyekigsglvtvivrgdvgavkaatdaga aaarnvgevkavhviprphtdvekil
Timeline for d4qiee_: