SCOPe 2.07: Domain d4qieh1: 4qie H:2-89

Lineage for d4qieh1 (4qie H:2-89)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.0: automated matches [195116] (1 protein)
   not a true family

6. Protein automated matches [195117] (12 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [257522] (6 PDB entries)

8. Domain d4qieh1: 4qie H:2-89 [273646]
   Other proteins in same PDB: d4qieh2
   automated match to d2a10f_
   complexed with gol, so4; mutant

Details for d4qieh1

PDB Entry: 4qie, 2.35 Å

PDB Description: crystal structure of pdua with edge mutation k26d

PDB Compounds: (H:) Propanediol utilization protein pduA

SCOPe Domain Sequences for d4qieh1:

Sequence; same for both SEQRES and ATOM records:

>d4qieh1 d.58.56.0 (H:2-89) automated matches {Salmonella enterica [TaxId: 99287]}
qqealgmvetkgltaaieaadamvdsanvmlvgyekigsglvtvivrgdvgavkaatdag
aaaarnvgevkavhviprphtdvekilp

Timeline for d4qieh1:

• d4qieh1 first appeared in SCOPe 2.05, called d4qieh_
  
• d4qieh1 appears in SCOPe 2.06
  
• d4qieh1 appears in the current release, SCOPe 2.08