Lineage for d1swld_ (1swl D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2806027Domain d1swld_: 1swl D: [27364]
    mutant

Details for d1swld_

PDB Entry: 1swl (more details), 1.8 Å

PDB Description: core-streptavidin mutant w108f at ph 7.0
PDB Compounds: (D:) core-streptavidin

SCOPe Domain Sequences for d1swld_:

Sequence, based on SEQRES records: (download)

>d1swld_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqflltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1swld_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesryvltgrydsapatdgsgtalgwtvawknn
yrnahsattwsgqyvggaearintqflltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1swld_:

Click to download the PDB-style file with coordinates for d1swld_.
(The format of our PDB-style files is described here.)

Timeline for d1swld_: