| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
| Family a.73.1.0: automated matches [227254] (1 protein) not a true family |
| Protein automated matches [227039] (3 species) not a true protein |
| Species Bovine leukemia virus [TaxId:11901] [273631] (3 PDB entries) |
| Domain d4ph0d1: 4ph0 D:1-125 [273637] Other proteins in same PDB: d4ph0a2, d4ph0b2, d4ph0c2, d4ph0d2, d4ph0e2, d4ph0f2 automated match to d1qrja2 |
PDB Entry: 4ph0 (more details), 2.75 Å
SCOPe Domain Sequences for d4ph0d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ph0d1 a.73.1.0 (D:1-125) automated matches {Bovine leukemia virus [TaxId: 11901]}
piisegnrnrhrawalrelqdikkeienkapgsqvwiqtlrlailqadptpadleqlcqy
iaspvdqtahmtsltaaiaaaeaantlqgfnpqngtltqqsaqpnagdlrsqyqnlwlqa
wknlp
Timeline for d4ph0d1: