![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.0: automated matches [227254] (1 protein) not a true family |
![]() | Protein automated matches [227039] (3 species) not a true protein |
![]() | Species Bovine leukemia virus [TaxId:11901] [273631] (3 PDB entries) |
![]() | Domain d4ph3b_: 4ph3 B: [273636] automated match to d1g03a_ complexed with gol, iod |
PDB Entry: 4ph3 (more details), 2.44 Å
SCOPe Domain Sequences for d4ph3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ph3b_ a.73.1.0 (B:) automated matches {Bovine leukemia virus [TaxId: 11901]} hrawalrelqdikkeienkapgsqvwiqtlrlailqadptpadleqlcqyiaspvdqtah mtsltaaiaaaeaantlqgfnpqngtltqqsaqpnagdlrsqyqnlwlqawknlp
Timeline for d4ph3b_: