SCOPe 2.05: Domain d4ph2a_: 4ph2 A:

Lineage for d4ph2a_ (4ph2 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.0: automated matches [227254] (1 protein)
   not a true family

6. Protein automated matches [227039] (3 species)
   not a true protein

7. Species Bovine leukemia virus [TaxId:11901] [273631] (3 PDB entries)

8. Domain d4ph2a_: 4ph2 A: [273633]
   automated match to d1g03a_
   complexed with gol, so4

Details for d4ph2a_

PDB Entry: 4ph2, 1.44 Å

PDB Description: mature n-terminal domain of capsid protein from bovine leukemia virus

PDB Compounds: (A:) BLV capsid - N-terminal domain

SCOPe Domain Sequences for d4ph2a_:

Sequence; same for both SEQRES and ATOM records:

>d4ph2a_ a.73.1.0 (A:) automated matches {Bovine leukemia virus [TaxId: 11901]}
piisegnrnrhrawalrelqdikkeienkapgsqvwiqtlrlailqadptpadleqlcqy
iaspvdqtahmtsltaaiaaaeaantlqgfnpqngtltqqsaqpnagdlrsqyqnlwlqa
wknlptr

Timeline for d4ph2a_:

• d4ph2a_ is new in SCOPe 2.05-stable
  
• d4ph2a_ appears in SCOPe 2.06
  
• d4ph2a_ appears in the current release, SCOPe 2.08