SCOPe 2.05: Domain d2mp1a_: 2mp1 A:

Lineage for d2mp1a_ (2mp1 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.0: automated matches [191483] (1 protein)
   not a true family

6. Protein automated matches [190775] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188003] (9 PDB entries)

8. Domain d2mp1a_: 2mp1 A: [273629]
   automated match to d1g91a_

Details for d2mp1a_

PDB Entry: 2mp1

PDB Description: solution structure of the human chemokine ccl19

PDB Compounds: (A:) C-C motif chemokine 19

SCOPe Domain Sequences for d2mp1a_:

Sequence; same for both SEQRES and ATOM records:

>d2mp1a_ d.9.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtndaedcclsvtqkpipgyivrnfhyllikdgcrvpavvfttlrgrqlcappdqpwver
iiqrlqrtsakmkrrss

Timeline for d2mp1a_:

• d2mp1a_ is new in SCOPe 2.05-stable
  
• d2mp1a_ appears in SCOPe 2.06
  
• d2mp1a_ appears in the current release, SCOPe 2.08