Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.0: automated matches [191483] (1 protein) not a true family |
Protein automated matches [190775] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188003] (9 PDB entries) |
Domain d2mp1a_: 2mp1 A: [273629] automated match to d1g91a_ |
PDB Entry: 2mp1 (more details)
SCOPe Domain Sequences for d2mp1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mp1a_ d.9.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gtndaedcclsvtqkpipgyivrnfhyllikdgcrvpavvfttlrgrqlcappdqpwver iiqrlqrtsakmkrrss
Timeline for d2mp1a_: