SCOPe 2.05: Domain d5a16h2: 5a16 H:112-218

Lineage for d5a16h2 (5a16 H:112-218)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Mus musculus [TaxId:10090] [272441] (35 PDB entries)
Domain d5a16h2: 5a16 H:112-218 [273626]
Other proteins in same PDB: d5a16b1, d5a16d1, d5a16f1, d5a16h1
automated match to d1tqbc2

Details for d5a16h2

PDB Entry: 5a16 (more details), 2.5 Å

PDB Description: crystal structure of fab4201 raised against human erythrocyte anion exchanger 1

PDB Compounds: (H:) fab4201 heavy chain

SCOPe Domain Sequences for d5a16h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a16h2 b.1.1.2 (H:112-218) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5a16h2:

Click to download the PDB-style file with coordinates for d5a16h2.
(The format of our PDB-style files is described here.)

Timeline for d5a16h2: