Lineage for d4zwmb_ (4zwm B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132988Species Toxoplasma gondii [TaxId:508771] [256372] (8 PDB entries)
  8. 2132996Domain d4zwmb_: 4zwm B: [273607]
    automated match to d4nogb_
    complexed with plp, so4

Details for d4zwmb_

PDB Entry: 4zwm (more details), 2.31 Å

PDB Description: 2.3 a resolution crystal structure of the ornithine aminotransferase from toxoplasma gondii me49
PDB Compounds: (B:) Ornithine aminotransferase, mitochondrial, putative

SCOPe Domain Sequences for d4zwmb_:

Sequence, based on SEQRES records: (download)

>d4zwmb_ c.67.1.0 (B:) automated matches {Toxoplasma gondii [TaxId: 508771]}
arktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfl
agvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntg
aeagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftp
gfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvlliv
deiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgst
fggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllna
vevdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflave
eerk

Sequence, based on observed residues (ATOM records): (download)

>d4zwmb_ c.67.1.0 (B:) automated matches {Toxoplasma gondii [TaxId: 508771]}
arktnieayrdglklkteedffacdrqyvcqnyavpvviskgkgarvwdingneyydfla
gvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntga
eagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpg
felidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivd
eiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstf
ggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnav
evdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflavee
erk

SCOPe Domain Coordinates for d4zwmb_:

Click to download the PDB-style file with coordinates for d4zwmb_.
(The format of our PDB-style files is described here.)

Timeline for d4zwmb_: