Lineage for d4zv3c2 (4zv3 C:222-371)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944462Species Mouse (Mus musculus) [TaxId:10090] [255553] (4 PDB entries)
  8. 2944482Domain d4zv3c2: 4zv3 C:222-371 [273597]
    automated match to d2v1ob_
    complexed with coa

Details for d4zv3c2

PDB Entry: 4zv3 (more details), 3.1 Å

PDB Description: crystal structure of the n- and c-terminal domains of mouse acyl-coa thioesterase 7
PDB Compounds: (C:) cytosolic acyl coenzyme a thioester hydrolase

SCOPe Domain Sequences for d4zv3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zv3c2 d.38.1.0 (C:222-371) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pepntvsysqsslihlvgpsdctlhgfvhggvtmklmdevagivaarhcktnivtasvda
infhdkirkgcvitisgrmtftsnksmeievlvdadpvvdnsqkryraasafftyvslnq
egkpmpvpqlvpetedekkrfeegkgrylq

SCOPe Domain Coordinates for d4zv3c2:

Click to download the PDB-style file with coordinates for d4zv3c2.
(The format of our PDB-style files is described here.)

Timeline for d4zv3c2: