SCOPe 2.08: Domain d4zv3c2: 4zv3 C:222-371

Lineage for d4zv3c2 (4zv3 C:222-371)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255553] (4 PDB entries)

8. Domain d4zv3c2: 4zv3 C:222-371 [273597]
   automated match to d2v1ob_
   complexed with coa

Details for d4zv3c2

PDB Entry: 4zv3, 3.1 Å

PDB Description: crystal structure of the n- and c-terminal domains of mouse acyl-coa thioesterase 7

PDB Compounds: (C:) cytosolic acyl coenzyme a thioester hydrolase

SCOPe Domain Sequences for d4zv3c2:

Sequence; same for both SEQRES and ATOM records:

>d4zv3c2 d.38.1.0 (C:222-371) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pepntvsysqsslihlvgpsdctlhgfvhggvtmklmdevagivaarhcktnivtasvda
infhdkirkgcvitisgrmtftsnksmeievlvdadpvvdnsqkryraasafftyvslnq
egkpmpvpqlvpetedekkrfeegkgrylq

Timeline for d4zv3c2:

• d4zv3c2 first appeared in SCOPe 2.05
  
• d4zv3c2 appears in SCOPe 2.07