Lineage for d4zr8b_ (4zr8 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2102173Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2102174Family c.1.22.1: Uroporphyrinogen decarboxylase, UROD [51727] (2 proteins)
    automatically mapped to Pfam PF01208
  6. 2102200Protein automated matches [195370] (3 species)
    not a true protein
  7. 2102201Species Acinetobacter baumannii [TaxId:1116234] [273591] (1 PDB entry)
  8. 2102203Domain d4zr8b_: 4zr8 B: [273592]
    automated match to d4wsha_
    complexed with cl, edo, mg

Details for d4zr8b_

PDB Entry: 4zr8 (more details), 1.5 Å

PDB Description: structure of uroporphyrinogen decarboxylase from acinetobacter baumannii
PDB Compounds: (B:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d4zr8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zr8b_ c.1.22.1 (B:) automated matches {Acinetobacter baumannii [TaxId: 1116234]}
lkndrflrallrepvdttpiwmmrqagrylpeyretrskagdflslckntefacevtlqp
lrrydldaailfsdiltipdalglglyfetgegpkfhktvrteqdvanlpklnakadldy
vmnavstirsalggqvpligfsgspwtlatymveggsskefrftkqmmyaqpevlhalld
hladsvidylnaqidagaqaiqifdswggalahreyvefslnymkkiiaglqrekdgrri
pvivftkgggqwlepmittgadalgldwttplntarttvagrvalqgnldpavlygsaas
iekavkamlddayangektgyvanlghgitqwvdpaqpkifvdtvheysakylg

SCOPe Domain Coordinates for d4zr8b_:

Click to download the PDB-style file with coordinates for d4zr8b_.
(The format of our PDB-style files is described here.)

Timeline for d4zr8b_: